Pharmaceutical raw materials used in synthesizing new medications

chemical-categories

Teduglutide LAB GRADE 95%

Creative peptides is specialized in the process development and the manufacturing of bioactive peptides. We offer custom peptide synthesis, process development, GMP manufacturing as well as catalog products. We provide Teduglutide. More information please visit the website:http://www.creative-peptides.com/product/teduglutide-item-m3412132-21367.html
CAT#
M3412132
Synonyms/Alias
Gattex; Glucagon-like peptide II [2-glycine] (human); ALX 0600
CAS No.
197922-42-2
Sequence
HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
M.W/Mr.
3752.13
Molecular Formula
C164H252N44O55S

Properties Suppliers
Telomerare Reverse Transcriptase (hTRT) (653-661) LAB GRADE 97%

Creative peptides is specialized in the process development and the manufacturing of bioactive peptides. We offer custom peptide synthesis, process development, GMP manufacturing as well as catalog products. We supply Telomerare Reverse Transcriptase (hTRT) (653-661).http://www.creative-peptides.com/product/telomerare-reverse-transcriptase-htrt-item-ta-568-31813.html

Properties Suppliers
Telomerase Reverse Transcriptase (hTRT) (674-683) LAB GRADE 97%

Creative peptides is specialized in the process development and the manufacturing of bioactive peptides. We offer custom peptide synthesis, process development, GMP manufacturing as well as catalog products. We supply Telomerase Reverse Transcriptase (hTRT) (674-683).http://www.creative-peptides.com/product/telomerase-reverse-transcriptase-htrt-item-ta-569-31814.html

Properties Suppliers
Telomerase reverse transcriptase (540-548) LAB GRADE 97%

Creative peptides is specialized in the process development and the manufacturing of bioactive peptides. We offer custom peptide synthesis, process development, GMP manufacturing as well as catalog products. We supply Telomerase reverse transcriptase (540-548).http://www.creative-peptides.com/product/telomerase-reverse-transcriptase-item-ta-408-29252.html

Properties Suppliers
Telomerase reverse transcriptase (672-686) LAB GRADE 97%

Creative peptides is specialized in the process development and the manufacturing of bioactive peptides. We offer custom peptide synthesis, process development, GMP manufacturing as well as catalog products. We supply Telomerase reverse transcriptase (672-686).http://www.creative-peptides.com/product/telomerase-reverse-transcriptase-item-ta-410-29256.html

Properties Suppliers
Telomerase reverse transcriptase (766-780) LAB GRADE 97%

Creative peptides is specialized in the process development and the manufacturing of bioactive peptides. We offer custom peptide synthesis, process development, GMP manufacturing as well as catalog products. We supply Telomerase reverse transcriptase (766-780).http://www.creative-peptides.com/product/telomerase-reverse-transcriptase-item-ta-411-29258.html

Properties Suppliers
Telomerase reverse transcriptase (865-873) LAB GRADE 97%

Creative peptides is specialized in the process development and the manufacturing of bioactive peptides. We offer custom peptide synthesis, process development, GMP manufacturing as well as catalog products. We supply Telomerase reverse transcriptase (865-873).http://www.creative-peptides.com/product/telomerase-reverse-transcriptase-item-ta-409-29255.html

Properties Suppliers
Telomerase reverse transcriptase (hTRT) (461-469) LAB GRADE 97%

Creative peptides is specialized in the process development and the manufacturing of bioactive peptides. We offer custom peptide synthesis, process development, GMP manufacturing as well as catalog products. We supply Telomerase reverse transcriptase (hTRT) (461-469).http://www.creative-peptides.com/product/telomerase-reverse-transcriptase-htrt-item-ta-574-31875.html

Properties Suppliers
Teriparatide Acetate

Welcome to inquiry!

Email: tony@kafenbio.com

WhatsApp: +8618002259573

Skype: tony_14616

www.pharmhormone.com

 

Properties Suppliers